PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_9158_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 523aa    MW: 57145.4 Da    PI: 6.3132
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_9158_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR21.16.3e-0710351642
            TCR 16 kYCeCfaagkkCseeCkCedCkNkeek 42
                   +YCeCfa+g +C+  C+C +C+N+ e+
  Neem_9158_f_1 10 QYCECFASGIYCDG-CNCVNCHNNVEN 35
                   7*************.********9875 PP

2TCR51.12.6e-1680119140
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Neem_9158_f_1  80 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 119
                    589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163431.5041120IPR005172CRC domain
SMARTSM011140.0021035IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-41032IPR005172CRC domain
SMARTSM011148.4E-2080121IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.8E-1383118IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MTNDDSLICQ YCECFASGIY CDGCNCVNCH NNVENEAARR EAVEATLERN PNAFRPKIAS  60
SPHGTRDNRE ETGEFLMLGK HNKGCHCKKS GCLKKYCECF QANILCSENC KCMDCKNFEG  120
SEERQALFHG DHANNMAYIQ QAANAAITGA IGSSGYASPP VSKKRKGKFF YCCFLLVYVA  180
NHIRPSTSST LSSIPVARAS SNAAMAPSKF TYRSLLADII QPQDLKELCS VLVVVAAEAA  240
KSLTDQRNAT EKQAEDQTAT SLASSGQDRL QSHKDSDVER TVTDDCSSAN QADKVGPDDS  300
GSDGSDVQKA RPMSPGTLAL MCDEQDTMFV ATASPNRLTR HGCNASSQLP YGQDMTEVYA  360
EQERDILLGK LVWHAFLQLV NFKIQTSVTE RLQLAHYEVS WSPSALFSLF LVIPCMLFAC  420
CDCWELMIHF HSNITETKFS SLSRSDLGSQ KDPLSNGRTE VGNQQAPVNN GIPKVFGSST  480
LAPPASKMSQ MVTTAIAISN DDPLRISALP GERDVKSKTE NKM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006475649.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-161TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A067DUG90.0A0A067DUG9_CITSI; Uncharacterized protein
STRINGVIT_11s0016g03680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-135Tesmin/TSO1-like CXC domain-containing protein